Lineage for d1azsc2 (1azs C:36-66,C:202-393)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 69650Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 69860Protein Transducin (alpha subunit) [52623] (2 species)
  7. 69861Species Cow (Bos taurus) [TaxId:9913] [52624] (11 PDB entries)
  8. 69869Domain d1azsc2: 1azs C:36-66,C:202-393 [32086]
    Other proteins in same PDB: d1azsa_, d1azsb_, d1azsc1

Details for d1azsc2

PDB Entry: 1azs (more details), 2.3 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase

SCOP Domain Sequences for d1azsc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1azsc2 c.37.1.8 (C:36-66,C:202-393) Transducin (alpha subunit) {Cow (Bos taurus)}
vyrathrllllgagesgkstivkqmrilhvnXvltsgifetkfqvdkvnfhmfdvggqrd
errkwiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvil
flnkqdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflris
tasgdgrhycyphftcavdtenirrvfndcrdiiqrmhlrqyel

SCOP Domain Coordinates for d1azsc2:

Click to download the PDB-style file with coordinates for d1azsc2.
(The format of our PDB-style files is described here.)

Timeline for d1azsc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1azsc1