SCOP 1.63: Domain d2ngra_: 2ngr A:

Lineage for d2ngra_ (2ngr A:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (31 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein CDC42 [52619] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52620] (15 PDB entries)

8. Domain d2ngra_: 2ngr A: [32061]
   Other proteins in same PDB: d2ngrb_
   complexed with gdp, mg; mutant

Details for d2ngra_

PDB Entry: 2ngr, 1.9 Å

PDB Description: transition state complex for gtp hydrolysis by cdc42: comparisons of the high resolution structures for cdc42 bound to the active and catalytically compromised forms of the cdc42-gap.

SCOP Domain Sequences for d2ngra_:

Sequence; same for both SEQRES and ATOM records:

>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens)}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
epkksrrcvll

Timeline for d2ngra_:

• d2ngra_ first appeared (with stable ids) in SCOP 1.55
  
• d2ngra_ appears in SCOP 1.61
  
• d2ngra_ appears in SCOP 1.65
  
• d2ngra_ appears in the current release, SCOPe 2.08