Lineage for d5k0wb_ (5k0w B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603526Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2603527Protein automated matches [190418] (31 species)
    not a true protein
  7. 2603553Species Elizabethkingia meningoseptica [TaxId:238] [320601] (1 PDB entry)
  8. 2603555Domain d5k0wb_: 5k0w B: [320602]
    automated match to d5aebb_
    complexed with cl, gol, zn

Details for d5k0wb_

PDB Entry: 5k0w (more details), 2.61 Å

PDB Description: crystal structure of the metallo-beta-lactamase gob-18 from elizabethkingia meningoseptica
PDB Compounds: (B:) Class B carbapenemase GOB-18

SCOPe Domain Sequences for d5k0wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k0wb_ d.157.1.0 (B:) automated matches {Elizabethkingia meningoseptica [TaxId: 238]}
vvkepenmpkewnqayepfriagnlyyvgtydlasylivtdkgnilintgtaesfpiika
niqklgfnykdikillltqahydhtgalqdfktetaakfyvdkadvdvlrtggksdyemg
kygvtfkpvtpdktlkdqdkiklgnitltllhhpghtkgscsfifetkdekrkyrvlian
mpsvivdkkfsevtaypniqsdyaytfgvmkkldfdiwvashasqfdlhekrkegdpynp
qlfmdkqsyfqnlndleksylnkikkdsqdk

SCOPe Domain Coordinates for d5k0wb_:

Click to download the PDB-style file with coordinates for d5k0wb_.
(The format of our PDB-style files is described here.)

Timeline for d5k0wb_: