Lineage for d1a2b__ (1a2b -)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) 
Family c.37.1.8: G proteins [52592] (26 proteins) 
Protein RhoA [52612] (1 species) Species Human (Homo sapiens) [TaxId:9606] [52613] (7 PDB entries) 
Domain d1a2b__: 1a2b - [32049]
Details for d1a2b__
PDB Entry: 1a2b (more details), 2.4 Å
PDB Description: human rhoa complexed with gtp analogue
SCOP Domain Sequences for d1a2b__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a2b__ c.37.1.8 (-) RhoA {Human (Homo sapiens)}
irkklvivgdvacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtagq
edydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrn
dehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa
SCOP Domain Coordinates for d1a2b__:
Click to download the PDB-style file with coordinates for d1a2b__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a2b__:
- d1a2b__ first appeared (with stable ids) in SCOP 1.55
- d1a2b__ appears in SCOP 1.59
- d1a2b__ appears in SCOP 1.63
- d1a2b__ appears in the current release, SCOPe 2.08, called d1a2ba_
View in 3D