Lineage for d1cxza_ (1cxz A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) 
Family c.37.1.8: G proteins [52592] (26 proteins) 
Protein RhoA [52612] (1 species) Species Human (Homo sapiens) [TaxId:9606] [52613] (7 PDB entries) 
Domain d1cxza_: 1cxz A: [32048]
Other proteins in same PDB: d1cxzb_
Details for d1cxza_
PDB Entry: 1cxz (more details), 2.2 Å
PDB Description: crystal structure of human rhoa complexed with the effector domain of the protein kinase pkn/prk1
SCOP Domain Sequences for d1cxza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cxza_ c.37.1.8 (A:) RhoA {Human (Homo sapiens)}
smaairkklvivgdvacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwd
tagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkk
dlrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraal
qa
SCOP Domain Coordinates for d1cxza_:
Click to download the PDB-style file with coordinates for d1cxza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cxza_:
- d1cxza_ first appeared (with stable ids) in SCOP 1.55
- d1cxza_ appears in SCOP 1.59
- d1cxza_ appears in SCOP 1.63
- d1cxza_ appears in the current release, SCOPe 2.08
View in 3D
