Lineage for d5a8wc_ (5a8w C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2561884Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2561885Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (2 proteins)
    automatically mapped to Pfam PF02240
  6. 2561922Protein automated matches [320245] (3 species)
    not a true protein
  7. 2561928Species Methanothermobacter wolfeii [TaxId:145261] [320246] (2 PDB entries)
  8. 2561931Domain d5a8wc_: 5a8w C: [320247]
    automated match to d3m2vc_
    complexed with act, com, f43, na, tp7

Details for d5a8wc_

PDB Entry: 5a8w (more details), 1.8 Å

PDB Description: methyl-coenzyme m reductase ii from methanothermobacter wolfeii at 1. 8 a resolution
PDB Compounds: (C:) methyl-coenzyme m reductase II

SCOPe Domain Sequences for d5a8wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a8wc_ d.58.31.1 (C:) automated matches {Methanothermobacter wolfeii [TaxId: 145261]}
sykaqytpgetriaenrrkhmnpdyelrklreisdedlvkvlghrnpgesyksvhpplde
mdfeedivrdlvepiqgakegvrvryiqfadsmynapaqpydrartymwryrgvdtgtls
grqviemreldlegvskelvetelfdpattgirgatvhghslrldenglmfdalqryvfd
eetghvvyvkeqvgrpldepvdmgqpldeeelrkittiyrkdniamrddkeaievvenih
tgrtmggfgmdvfkedlrkrlgd

SCOPe Domain Coordinates for d5a8wc_:

Click to download the PDB-style file with coordinates for d5a8wc_.
(The format of our PDB-style files is described here.)

Timeline for d5a8wc_: