Class a: All alpha proteins [46456] (289 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.10: Stathmin [101494] (1 family) single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
Family a.137.10.1: Stathmin [101495] (2 proteins) |
Protein Stathmin 4 [101496] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (178 PDB entries) |
Domain d4zi7e_: 4zi7 E: [320235] Other proteins in same PDB: d4zi7a1, d4zi7a2, d4zi7b1, d4zi7b2, d4zi7c1, d4zi7c2, d4zi7d1, d4zi7d2, d4zi7f1, d4zi7f2, d4zi7f3 automated match to d4i55e_ complexed with 4sl, acp, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 4zi7 (more details), 2.51 Å
SCOPe Domain Sequences for d4zi7e_:
Sequence, based on SEQRES records: (download)
>d4zi7e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelkeea
>d4zi7e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk eea
Timeline for d4zi7e_: