Lineage for d5dn2b_ (5dn2 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384653Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2384654Protein automated matches [190770] (49 species)
    not a true protein
  7. 2384921Species Human (Homo sapiens) [TaxId:9606] [188939] (29 PDB entries)
  8. 2384933Domain d5dn2b_: 5dn2 B: [319866]
    automated match to d1kexa_
    complexed with dio, gol

Details for d5dn2b_

PDB Entry: 5dn2 (more details), 1.95 Å

PDB Description: human nrp2 b1 domain in complex with the peptide corresponding to the c-terminus of vegf-a
PDB Compounds: (B:) Neuropilin-2

SCOPe Domain Sequences for d5dn2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dn2b_ b.18.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mfqcnvplgmesgrianeqisasstysdgrwtpqqsrlhgddngwtpnldsnkeylqvdl
rfltmltaiatqgaisretqngyyvksyklevstngedwmvyrhgknhkvfqanndatev
vlnklhaplltrfvrirpqtwhsgialrlelfgcrv

SCOPe Domain Coordinates for d5dn2b_:

Click to download the PDB-style file with coordinates for d5dn2b_.
(The format of our PDB-style files is described here.)

Timeline for d5dn2b_: