Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
Superfamily c.116.1: alpha/beta knot [75217] (9 families) known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
Family c.116.1.0: automated matches [191557] (1 protein) not a true family |
Protein automated matches [190961] (22 species) not a true protein |
Species Thermus thermophilus [TaxId:262724] [319700] (1 PDB entry) |
Domain d5co4a1: 5co4 A:1-149 [319745] Other proteins in same PDB: d5co4a2, d5co4b2 automated match to d1mxia_ complexed with gol, mta |
PDB Entry: 5co4 (more details), 1.7 Å
SCOPe Domain Sequences for d5co4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5co4a1 c.116.1.0 (A:1-149) automated matches {Thermus thermophilus [TaxId: 262724]} mlhlvlyqpeipqnagnvartaaalgwplhlirplgfllsspklkragldywphvdlrlh dsfaaflealprgarvfafsargeaslyearfregdyllfgpesrglpeevlarfptlki pmpgpvrslnlavavgvaayeayrqltgr
Timeline for d5co4a1: