SCOPe 2.07: Domain d5js6a1: 5js6 A:4-270

Lineage for d5js6a1 (5js6 A:4-270)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein automated matches [190085] (58 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186828] (33 PDB entries)

8. Domain d5js6a1: 5js6 A:4-270 [319636]
   Other proteins in same PDB: d5js6a2
   automated match to d1ydef_
   complexed with cl, nad, pg4, pge

Details for d5js6a1

PDB Entry: 5js6, 2 Å

PDB Description: crystal structure of 17beta-hydroxysteroid dehydrogenase 14 t205 variant in complex with nad.

PDB Compounds: (A:) 17-beta-hydroxysteroid dehydrogenase 14

SCOPe Domain Sequences for d5js6a1:

Sequence; same for both SEQRES and ATOM records:

>d5js6a1 c.2.1.2 (A:4-270) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv
tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk
lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis
pgniwtplweelaalmpdpratiregmlaqplgrmgqpaevgaaavflaseanfctgiel
lvtggaelgygckasrstpvdapdips

Timeline for d5js6a1:

• d5js6a1 first appeared in SCOPe 2.06
  
• d5js6a1 appears in the current release, SCOPe 2.08