Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (156 species) not a true protein |
Species Zika virus [TaxId:64320] [317810] (28 PDB entries) |
Domain d5jrza2: 5jrz A:482-617 [319630] Other proteins in same PDB: d5jrza1 automated match to d2bmfa1 complexed with act, pop |
PDB Entry: 5jrz (more details), 1.62 Å
SCOPe Domain Sequences for d5jrza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jrza2 c.37.1.0 (A:482-617) automated matches {Zika virus [TaxId: 64320]} edhahwlearmlldniylqdgliaslyrpeadkvaaiegefklrteqrktfvelmkrgdl pvwlayqvasagitytdrrwcfdgttnntimedsvpaevwtrhgekrvlkprwmdarvcs dhaalksfkefaagkr
Timeline for d5jrza2: