Lineage for d5fnea_ (5fne A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2333057Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2333058Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2333804Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2333805Protein automated matches [191104] (14 species)
    not a true protein
  7. 2333942Species Pleurotus eryngii [TaxId:5323] [226503] (19 PDB entries)
  8. 2333955Domain d5fnea_: 5fne A: [319477]
    automated match to d3fjwa_
    complexed with ca, hem, so4; mutant

Details for d5fnea_

PDB Entry: 5fne (more details), 1.5 Å

PDB Description: crystal structure of fungal versatile peroxidase from pleurotus eryngii triple mutant e37k, h39r & g330r
PDB Compounds: (A:) versatile peroxidase

SCOPe Domain Sequences for d5fnea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fnea_ a.93.1.0 (A:) automated matches {Pleurotus eryngii [TaxId: 5323]}
atcddgrttanaaccilfpilddiqenlfdgaqcgekvreslrltfhdaigfsptlgggg
adgsiiafdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri
pfflgrpdavaaspdhlvpepfdsvdsilarmgdagfspvevvwllashsiaaadkvdps
ipgtpfdstpgvfdsqffietqlkgrlfpgtadnkgeaqsplqgeirlqsdhllardpqt
acewqsmvnnqpkiqnrfaatmskmallgqdktklidcsdviptppalvgaahlpagfsl
sdveqacaatpfpaltadpgpvtsvppvp

SCOPe Domain Coordinates for d5fnea_:

Click to download the PDB-style file with coordinates for d5fnea_.
(The format of our PDB-style files is described here.)

Timeline for d5fnea_: