![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
![]() | Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) ![]() |
![]() | Family f.10.1.0: automated matches [227258] (1 protein) not a true family |
![]() | Protein automated matches [227047] (11 species) not a true protein |
![]() | Species Zika virus [TaxId:64320] [317278] (7 PDB entries) |
![]() | Domain d5lbvb1: 5lbv B:1-303 [319380] Other proteins in same PDB: d5lbva2, d5lbvb2 automated match to d4gsxa1 complexed with bma, fuc, man, na, nag |
PDB Entry: 5lbv (more details), 2.2 Å
SCOPe Domain Sequences for d5lbvb1:
Sequence, based on SEQRES records: (download)
>d5lbvb1 f.10.1.0 (B:1-303) automated matches {Zika virus [TaxId: 64320]} ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa cskkmtgksiqpenleyrimlsvhgsqhsgmivndtghetdenrakveitpnspraeatl ggfgslgldceprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnke alvefkdahakrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrl kgv
>d5lbvb1 f.10.1.0 (B:1-303) automated matches {Zika virus [TaxId: 64320]} ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa cskkmtgksiqpenleyrimlsvhgsqhsgmivndtghetdenrakveitpnspraeatl ggfgslgldcepfsdlyyltmnnkhwlvhkewfhdiplpwhagaphwnnkealvefkdah akrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrlkgv
Timeline for d5lbvb1: