Lineage for d5b5vc_ (5b5v C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2322039Superfamily a.29.7: Mob1/phocein [101152] (2 families) (S)
    common fold is elaborated with additional short helices; contains a zinc-binding site
    automatically mapped to Pfam PF03637
  5. 2322040Family a.29.7.1: Mob1/phocein [101153] (2 proteins)
  6. 2322046Protein automated matches [319235] (2 species)
    not a true protein
  7. 2322059Species Mouse (Mus musculus) [TaxId:10090] [319236] (2 PDB entries)
  8. 2322062Domain d5b5vc_: 5b5v C: [319368]
    automated match to d1pi1a_
    complexed with cl, zn

Details for d5b5vc_

PDB Entry: 5b5v (more details), 2.19 Å

PDB Description: structure of full-length mob1b
PDB Compounds: (C:) MOB kinase activator 1B

SCOPe Domain Sequences for d5b5vc_:

Sequence, based on SEQRES records: (download)

>d5b5vc_ a.29.7.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pegshqyellkhaeatlgsgnlrmavmlpegedlnewvavntvdffnqinmlygtitdfc
teescpvmsagpkyeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigvp
fpknfmsvaktilkrlfrvyahiyhqhfdpviqlqeeahlntsfkhfiffvqefnlidrr
elaplqeliekl

Sequence, based on observed residues (ATOM records): (download)

>d5b5vc_ a.29.7.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pegshqyellkhaeatlgsgnlrmavmlpegedlnewvavntvdffnqinmlygtitdfc
teescpvmsagpkyeyhwadgpikcsapkyidylmtwvqdqlddetlfpskigvpfpknf
msvaktilkrlfrvyahiyhqhfdpviqlqeeahlntsfkhfiffvqefnlidrrelapl
qeliekl

SCOPe Domain Coordinates for d5b5vc_:

Click to download the PDB-style file with coordinates for d5b5vc_.
(The format of our PDB-style files is described here.)

Timeline for d5b5vc_: