SCOP 1.59: Domain d1qhxa_: 1qhx A:

Lineage for d1qhxa_ (1qhx A:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families)

5. Family c.37.1.3: Chloramphenicol phosphotransferase [52569] (1 protein)

6. Protein Chloramphenicol phosphotransferase [52570] (1 species)

7. Species Streptomyces venezuelae [TaxId:54571] [52571] (6 PDB entries)

8. Domain d1qhxa_: 1qhx A: [31936]

Details for d1qhxa_

PDB Entry: 1qhx, 2.5 Å

PDB Description: chloramphenicol phosphotransferase in complex with atp from streptomyces venezuelae

SCOP Domain Sequences for d1qhxa_:

Sequence; same for both SEQRES and ATOM records:

>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae}
mttrmiilnggssagksgivrclqsvlpepwlafgvdslieamplkmqsaeggiefdadg
gvsigpefralegawaegvvamaragariiiddvflggaaaqerwrsfvgdldvlwvgvr
cdgavaegretargdrvagmaakqayvvhegveydvevdtthkesiecawaiaahvvp

Timeline for d1qhxa_:

• d1qhxa_ first appeared (with stable ids) in SCOP 1.55
  
• d1qhxa_ appears in SCOP 1.57
  
• d1qhxa_ appears in SCOP 1.61
  
• d1qhxa_ appears in the current release, SCOPe 2.08