Lineage for d1zin_1 (1zin 1-125,161-217)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179164Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (15 proteins)
  6. 179165Protein Adenylate kinase [52554] (8 species)
  7. 179173Species Bacillus stearothermophilus [TaxId:1422] [52562] (3 PDB entries)
  8. 179174Domain d1zin_1: 1zin 1-125,161-217 [31915]
    Other proteins in same PDB: d1zin_2

Details for d1zin_1

PDB Entry: 1zin (more details), 1.6 Å

PDB Description: adenylate kinase with bound ap5a

SCOP Domain Sequences for d1zin_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zin_1 c.37.1.1 (1-125,161-217) Adenylate kinase {Bacillus stearothermophilus}
mnlvlmglpgagkgtqaekivaaygiphistgdmfraamkegtplglqakqymdrgdlvp
devtigivrerlskddcqngflldgfprtvaqaealetmladigrkldyvihidvrqdvl
merltXaddneatvanrlevnmkqmkplvdfyeqkgylrningeqdmekvfadirellgg
lar

SCOP Domain Coordinates for d1zin_1:

Click to download the PDB-style file with coordinates for d1zin_1.
(The format of our PDB-style files is described here.)

Timeline for d1zin_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zin_2