Lineage for d5c71b2 (5c71 B:181-275)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2372434Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2372926Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2372927Protein automated matches [254633] (16 species)
    not a true protein
  7. 2373236Species Fungus (Aspergillus oryzae) [TaxId:5062] [318527] (2 PDB entries)
  8. 2373238Domain d5c71b2: 5c71 B:181-275 [318917]
    Other proteins in same PDB: d5c71a1, d5c71a3, d5c71b1, d5c71b3, d5c71c1, d5c71c3, d5c71d1, d5c71d3
    automated match to d5czkb2
    complexed with cbw, gcu

Details for d5c71b2

PDB Entry: 5c71 (more details), 2.62 Å

PDB Description: the structure of aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide
PDB Compounds: (B:) Glucuronidase

SCOPe Domain Sequences for d5c71b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c71b2 b.1.4.0 (B:181-275) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]}
qhiqditvrtdvqgttglidynvvasttqgtiqvavidedgttvatssgsngtihipsvh
lwqpgaaylyqlhasiidsskktidtyklatgirt

SCOPe Domain Coordinates for d5c71b2:

Click to download the PDB-style file with coordinates for d5c71b2.
(The format of our PDB-style files is described here.)

Timeline for d5c71b2: