Lineage for d4zxpb1 (4zxp B:3-197)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889282Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2889299Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 2889300Protein automated matches [193326] (11 species)
    not a true protein
  7. 2889378Species Vibrio cholerae [TaxId:243277] [311867] (9 PDB entries)
  8. 2889380Domain d4zxpb1: 4zxp B:3-197 [318847]
    Other proteins in same PDB: d4zxpa2, d4zxpb2
    automated match to d4y2zb_
    complexed with flc

Details for d4zxpb1

PDB Entry: 4zxp (more details), 1.63 Å

PDB Description: crystal structure of peptidyl- trna hydrolase from vibrio cholerae
PDB Compounds: (B:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d4zxpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zxpb1 c.56.3.0 (B:3-197) automated matches {Vibrio cholerae [TaxId: 243277]}
sqpikllvglanpgpeyaktrhnagawvveelarihnvtlknepkffgltgrllinsqel
rvlipttfmnlsgkaiaalanfyqikpeeimvahdeldlppgvakfkqggghgghnglkd
tisklgnnkefyrlrlgighpghkdkvagyvlgkapakeqecldaavdesvrcleilmkd
gltkaqnrlhtfkae

SCOPe Domain Coordinates for d4zxpb1:

Click to download the PDB-style file with coordinates for d4zxpb1.
(The format of our PDB-style files is described here.)

Timeline for d4zxpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zxpb2