Lineage for d5a37a1 (5a37 A:34-148)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325181Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2325182Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2325260Family a.40.1.0: automated matches [227151] (1 protein)
    not a true family
  6. 2325261Protein automated matches [226856] (4 species)
    not a true protein
  7. 2325267Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries)
  8. 2325290Domain d5a37a1: 5a37 A:34-148 [318726]
    automated match to d1wkua1
    mutant

Details for d5a37a1

PDB Entry: 5a37 (more details), 1.88 Å

PDB Description: mutations in the calponin homology domain of alpha-actinin-2 affect actin binding and incorporation in muscle.
PDB Compounds: (A:) human alpha-actinin-2

SCOPe Domain Sequences for d5a37a1:

Sequence, based on SEQRES records: (download)

>d5a37a1 a.40.1.0 (A:34-148) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pawekqqrktftawcnshlrkagtqienieedfrnglklmlllevisgerlpkpdrgkmr
fhkianvnkaldyiaskvvklvsigaeeivdgnvkmtlgmiwtiilrfaiqdisv

Sequence, based on observed residues (ATOM records): (download)

>d5a37a1 a.40.1.0 (A:34-148) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pawekqqrktftawcnshlrkagtqienieedfrnglklmlllevisgerlpkpdrgkmr
fhkianvnkaldyiaskvvigaeeivdgnvkmtlgmiwtiilrfaiqdisv

SCOPe Domain Coordinates for d5a37a1:

Click to download the PDB-style file with coordinates for d5a37a1.
(The format of our PDB-style files is described here.)

Timeline for d5a37a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5a37a2