Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (28 PDB entries) |
Domain d5dhyl_: 5dhy L: [318714] automated match to d3t0va_ |
PDB Entry: 5dhy (more details), 3.1 Å
SCOPe Domain Sequences for d5dhyl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dhyl_ b.1.1.0 (L:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} elvmtqtpssvsepvggtvtikcqasqsisswlswyqqkpgqppklliydasnlasgvps rfmgsgsgteytltisgvqredaatyyclggypaasyrtafgggteleii
Timeline for d5dhyl_: