Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
Protein automated matches [191164] (24 species) not a true protein |
Species Pig roundworm (Ascaris suum) [TaxId:6253] [256141] (8 PDB entries) |
Domain d5c3jb1: 5c3j B:33-138 [318705] Other proteins in same PDB: d5c3jb2, d5c3jf2 automated match to d4ysxb1 complexed with eph, f3s, fad, fes, hem, mli, sf4, uq1 |
PDB Entry: 5c3j (more details), 2.8 Å
SCOPe Domain Sequences for d5c3jb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c3jb1 d.15.4.0 (B:33-138) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]} kriktfeiyrfnpeepgakpklqkfdvdldkcgtmvldalikiknevdptltfrrscreg icgscamniagentlacicnidqntskttkiyplphmfvikdlvpd
Timeline for d5c3jb1: