SCOPe 2.07: Domain d5c3jb1: 5c3j B:33-138

Lineage for d5c3jb1 (5c3j B:33-138)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (24 species)
   not a true protein

7. Species Pig roundworm (Ascaris suum) [TaxId:6253] [256141] (8 PDB entries)

8. Domain d5c3jb1: 5c3j B:33-138 [318705]
   Other proteins in same PDB: d5c3jb2, d5c3jf2
   automated match to d4ysxb1
   complexed with eph, f3s, fad, fes, hem, mli, sf4, uq1

Details for d5c3jb1

PDB Entry: 5c3j, 2.8 Å

PDB Description: crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with ubiquinone-1

PDB Compounds: (B:) Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d5c3jb1:

Sequence; same for both SEQRES and ATOM records:

>d5c3jb1 d.15.4.0 (B:33-138) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]}
kriktfeiyrfnpeepgakpklqkfdvdldkcgtmvldalikiknevdptltfrrscreg
icgscamniagentlacicnidqntskttkiyplphmfvikdlvpd

Timeline for d5c3jb1:

• d5c3jb1 first appeared in SCOPe 2.06
  
• d5c3jb1 appears in the current release, SCOPe 2.08