Class b: All beta proteins [48724] (178 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries) |
Domain d5c5bb2: 5c5b B:274-374 [318689] Other proteins in same PDB: d5c5ba1, d5c5ba3, d5c5bb1, d5c5bc1, d5c5bc3, d5c5bd1 automated match to d2z0oa2 complexed with gol |
PDB Entry: 5c5b (more details), 2.9 Å
SCOPe Domain Sequences for d5c5bb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c5bb2 b.55.1.0 (B:274-374) automated matches {Human (Homo sapiens) [TaxId: 9606]} nrnliqkagylnlrnktglvtttwerlyfftqggnlmcqprgavaggliqdldncsvmav dcedrrycfqittpngksgiilqaesrkeneewicainnis
Timeline for d5c5bb2: