Lineage for d5c5bb2 (5c5b B:274-374)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412582Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2412583Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2413229Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2413230Protein automated matches [190052] (8 species)
    not a true protein
  7. 2413308Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)
  8. 2413443Domain d5c5bb2: 5c5b B:274-374 [318689]
    Other proteins in same PDB: d5c5ba1, d5c5ba3, d5c5bb1, d5c5bc1, d5c5bc3, d5c5bd1
    automated match to d2z0oa2
    complexed with gol

Details for d5c5bb2

PDB Entry: 5c5b (more details), 2.9 Å

PDB Description: crystal structure of human appl bar-ph heterodimer
PDB Compounds: (B:) DCC-interacting protein 13-beta

SCOPe Domain Sequences for d5c5bb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c5bb2 b.55.1.0 (B:274-374) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nrnliqkagylnlrnktglvtttwerlyfftqggnlmcqprgavaggliqdldncsvmav
dcedrrycfqittpngksgiilqaesrkeneewicainnis

SCOPe Domain Coordinates for d5c5bb2:

Click to download the PDB-style file with coordinates for d5c5bb2.
(The format of our PDB-style files is described here.)

Timeline for d5c5bb2: