SCOP 1.65: Domain d4ukd__: 4ukd -

Lineage for d4ukd__ (4ukd -)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (16 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein UMP/CMP kinase [52550] (1 species)

7. Species Dictyostelium discoideum [TaxId:44689] [52551] (6 PDB entries)

8. Domain d4ukd__: 4ukd - [31850]
   complexed with adp, bf2, mg, udp

Details for d4ukd__

PDB Entry: 4ukd, 2 Å

PDB Description: ump/cmp kinase from slime mold complexed with adp, udp, beryllium fluoride

SCOP Domain Sequences for d4ukd__:

Sequence; same for both SEQRES and ATOM records:

>d4ukd__ c.37.1.1 (-) UMP/CMP kinase {Dictyostelium discoideum}
skpnvvfvlggpgsgkgtqcanivrdfgwvhlsagdllrqeqqsgskdgemiatmiknge
ivpsivtvkllknaidanqgknflvdgfprneennnsweenmkdfvdtkfvlffdcpeev
mtqrllkrgessgrsddniesikkrfntfnvqtklvidhynkfdkvkiipanrdvnevyn
dvenlfksmgf

Timeline for d4ukd__:

• d4ukd__ first appeared (with stable ids) in SCOP 1.55
  
• d4ukd__ appears in SCOP 1.63
  
• d4ukd__ appears in SCOP 1.67
  
• d4ukd__ appears in the current release, SCOPe 2.08, called d4ukda_