Lineage for d5icca2 (5icc A:105-350)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2502162Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2502163Protein automated matches [190689] (81 species)
    not a true protein
  7. 2502711Species Thalictrum flavum [TaxId:150095] [318181] (8 PDB entries)
  8. 2502720Domain d5icca2: 5icc A:105-350 [318249]
    Other proteins in same PDB: d5icca1, d5icca3
    automated match to d1fp2a2
    complexed with edo, k, na, sah

Details for d5icca2

PDB Entry: 5icc (more details), 1.9 Å

PDB Description: crystal structure of (s)-norcoclaurine 6-o-methyltransferase with s- adenosyl-l-homocysteine
PDB Compounds: (A:) (S)-norcoclaurine 6-O-methyltransferase

SCOPe Domain Sequences for d5icca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5icca2 c.66.1.0 (A:105-350) automated matches {Thalictrum flavum [TaxId: 150095]}
kcmlgailtitdkdfmapwhylkegilndgststafekalgtniwdymaehpeknqlfne
gmandtrlimsalvkecssmfdgittivdvgggtgtavrniakafphikctvydlphvia
dspgyteinsiqgdmfkyipnadaimmkcilhdwddkecieilkrckdavprdggkviii
diildvksehpytkmrltldldmmlntggkerteeewkklihdagykgykithisavqsv
ieaypy

SCOPe Domain Coordinates for d5icca2:

Click to download the PDB-style file with coordinates for d5icca2.
(The format of our PDB-style files is described here.)

Timeline for d5icca2: