SCOP 1.65: Domain d1tkaa1: 1tka A:3-337

Lineage for d1tkaa1 (1tka A:3-337)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.10: TK-like PP module [88760] (2 proteins)
   different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain

6. Protein Transketolase (TK), PP module [88761] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88762] (7 PDB entries)

8. Domain d1tkaa1: 1tka A:3-337 [31815]
   Other proteins in same PDB: d1tkaa2, d1tkaa3, d1tkab2, d1tkab3

Details for d1tkaa1

PDB Entry: 1tka, 2.7 Å

PDB Description: specificity of coenzyme binding in thiamin diphosphate dependent enzymes: crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate

SCOP Domain Sequences for d1tkaa1:

Sequence; same for both SEQRES and ATOM records:

>d1tkaa1 c.36.1.10 (A:3-337) Transketolase (TK), PP module {Baker's yeast (Saccharomyces cerevisiae)}
qftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinrdr
fvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgqgi
snavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnlia
iyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdkpt
likmtttigygslhagshsvhgaplkaddvkqlkskfgfnpdksfvvpqevydhyqktil
kpgveannkwnklfseyqkkfpelgaelarrlsgq

Timeline for d1tkaa1:

• d1tkaa1 first appeared (with stable ids) in SCOP 1.55
  
• d1tkaa1 appears in SCOP 1.63
  
• d1tkaa1 appears in SCOP 1.67
  
• d1tkaa1 appears in the current release, SCOPe 2.08