SCOPe 2.07: Domain d5hggt1: 5hgg T:6-127

Lineage for d5hggt1 (5hgg T:6-127)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (79 PDB entries)

8. Domain d5hggt1: 5hgg T:6-127 [317980]
   Other proteins in same PDB: d5hgga_, d5hggb_, d5hggt2
   automated match to d2vyrh_
   complexed with gol, mes, so4, twn

Details for d5hggt1

PDB Entry: 5hgg, 1.97 Å

PDB Description: crystal structure of upa in complex with a camelid-derived antibody fragment

PDB Compounds: (T:) Camelid Derived Antibody Fragment, Nb4

SCOPe Domain Sequences for d5hggt1:

Sequence; same for both SEQRES and ATOM records:

>d5hggt1 b.1.1.1 (T:6-127) automated matches {Vicugna pacos [TaxId: 30538]}
esggglvqaggslrlscaasgftldsyaigwfrqapgkeregvscisasggstnyadsvk
grftisrdnakntvylqmnslksedtavyycaadhpglctsesgrrrylevwgqgtqvtv
ss

Timeline for d5hggt1:

• d5hggt1 first appeared in SCOPe 2.06, called d5hggt_
  
• d5hggt1 appears in the current release, SCOPe 2.08