Lineage for d1pydb2 (1pyd B:2-181)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864564Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2864565Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2864566Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
    automatically mapped to Pfam PF02776
  6. 2864691Protein Pyruvate decarboxylase [88725] (3 species)
  7. 2864697Species Brewer's yeast (Saccharomyces uvarum) [TaxId:230603] [88726] (1 PDB entry)
  8. 2864699Domain d1pydb2: 1pyd B:2-181 [31775]
    Other proteins in same PDB: d1pyda1, d1pyda3, d1pydb1, d1pydb3
    complexed with mg, tdp

Details for d1pydb2

PDB Entry: 1pyd (more details), 2.4 Å

PDB Description: catalytic centers in the thiamin diphosphate dependent enzyme pyruvate decarboxylase at 2.4 angstroms resolution
PDB Compounds: (B:) pyruvate decarboxylase

SCOPe Domain Sequences for d1pydb2:

Sequence, based on SEQRES records: (download)

>d1pydb2 c.36.1.5 (B:2-181) Pyruvate decarboxylase {Brewer's yeast (Saccharomyces uvarum) [TaxId: 230603]}
seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy
arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsissqakqlllhhtlgngd
ftvfhrmsanisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakll

Sequence, based on observed residues (ATOM records): (download)

>d1pydb2 c.36.1.5 (B:2-181) Pyruvate decarboxylase {Brewer's yeast (Saccharomyces uvarum) [TaxId: 230603]}
seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy
arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsishhtlgngdftvfhrms
anisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakll

SCOPe Domain Coordinates for d1pydb2:

Click to download the PDB-style file with coordinates for d1pydb2.
(The format of our PDB-style files is described here.)

Timeline for d1pydb2: