SCOPe 2.08: Domain d1pyda3: 1pyd A:361-556

Lineage for d1pyda3 (1pyd A:361-556)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology

6. Protein Pyruvate decarboxylase [88750] (3 species)

7. Species Brewer's yeast (Saccharomyces uvarum) [TaxId:230603] [88751] (1 PDB entry)

8. Domain d1pyda3: 1pyd A:361-556 [31774]
   Other proteins in same PDB: d1pyda1, d1pyda2, d1pydb1, d1pydb2
   complexed with mg, tdp

Details for d1pyda3

PDB Entry: 1pyd, 2.4 Å

PDB Description: catalytic centers in the thiamin diphosphate dependent enzyme pyruvate decarboxylase at 2.4 angstroms resolution

PDB Compounds: (A:) pyruvate decarboxylase

SCOPe Domain Sequences for d1pyda3:

Sequence; same for both SEQRES and ATOM records:

>d1pyda3 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Brewer's yeast (Saccharomyces uvarum) [TaxId: 230603]}
astplkqewmwnqlgnflqegdvviaetgtsafginqttfpnntygisqvlwgsigfttg
atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytiekli
hgpkaqyneiqgwdhlsllptfgakdyethrvattgewdkltqdksfndnskirmieiml
pvfdapqnlvkqaklt

Timeline for d1pyda3:

• d1pyda3 first appeared (with stable ids) in SCOP 1.55
  
• d1pyda3 appears in SCOPe 2.07