Lineage for d5a7ea2 (5a7e A:130-298)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381958Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2381959Protein automated matches [190824] (29 species)
    not a true protein
  7. 2382137Species Coriolopsis gallica [TaxId:76126] [256171] (9 PDB entries)
  8. 2382151Domain d5a7ea2: 5a7e A:130-298 [317711]
    automated match to d4a2ea2
    complexed with act, bgc, cu, nag

Details for d5a7ea2

PDB Entry: 5a7e (more details), 1.5 Å

PDB Description: crystallographic structural determination of a trigonal laccase from coriolopsis gallica (cgl) to 1.5 a resolution
PDB Compounds: (A:) coriolopsis gallica laccase

SCOPe Domain Sequences for d5a7ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a7ea2 b.6.1.0 (A:130-298) automated matches {Coriolopsis gallica [TaxId: 76126]}
dphkslydvdddstvitladwyhlaakvgapvptadatlinglgrssstlaadlavitvt
kgkryrfrlvslscdpnytfsidghsltvieadsvnlkphtvdslqifaaqrysfvlnad
qdvdnywiralpnsgtqnfaggtnsailrydgaapvepttsqtpstnpl

SCOPe Domain Coordinates for d5a7ea2:

Click to download the PDB-style file with coordinates for d5a7ea2.
(The format of our PDB-style files is described here.)

Timeline for d5a7ea2: