Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein automated matches [226837] (10 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [278808] (54 PDB entries) |
Domain d5jqga1: 5jqg A:1-245 [317542] Other proteins in same PDB: d5jqga2, d5jqgb1, d5jqgb2, d5jqgc2, d5jqgd1, d5jqgd2, d5jqge_, d5jqgf1, d5jqgf2, d5jqgf3 automated match to d4ihja1 complexed with acp, ca, cl, gdp, gtp, mes, mg |
PDB Entry: 5jqg (more details), 2.24 Å
SCOPe Domain Sequences for d5jqga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jqga1 c.32.1.1 (A:1-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]} mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita slrfd
Timeline for d5jqga1: