![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
![]() | Protein Tubulin alpha-subunit [52494] (3 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [52495] (3 PDB entries) |
![]() | Domain d1tuba1: 1tub A:1-245 [31751] Other proteins in same PDB: d1tuba2, d1tubb1, d1tubb2 complexed with gdp, gtp, txl |
PDB Entry: 1tub (more details), 3.7 Å
SCOPe Domain Sequences for d1tuba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tuba1 c.32.1.1 (A:1-245) Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 9823]} mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld rirkladqctglqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssita slrfd
Timeline for d1tuba1: