Lineage for d5jlac_ (5jla C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846447Species Burkholderia xenovorans [TaxId:266265] [317032] (3 PDB entries)
  8. 2846450Domain d5jlac_: 5jla C: [317351]
    automated match to d4wuva_
    complexed with nad

Details for d5jlac_

PDB Entry: 5jla (more details), 1.45 Å

PDB Description: crystal structure of ribose-5-phosphate isomerase from brucella melitensis 16m
PDB Compounds: (C:) putative short-chain dehydrogenase/reductase

SCOPe Domain Sequences for d5jlac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jlac_ c.2.1.0 (C:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
asaefngaiavvtgagsgigracaellsrsganvivadrdieaatrvaratggktlvldv
gedasvtaaanevrarygvadvlvncagvlqrtlppgelaqrewdvvsridlrgtylcca
afgapmadrrrgsivniasvagmrsgplhaygpakagvisltetlagewgpkgvrvncvs
pgftqtpalergftthtlkadvlrdaaalghivsaneiaeavvflaserasaitgvnlpv
dagyliagswaaygglrr

SCOPe Domain Coordinates for d5jlac_:

Click to download the PDB-style file with coordinates for d5jlac_.
(The format of our PDB-style files is described here.)

Timeline for d5jlac_: