Lineage for d5hukb1 (5huk B:83-469)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
consists of six 4-stranded beta-sheet motifs; meander
Superfamily b.68.1: Sialidases [50939] (3 families) 
Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins) 
Protein Influenza neuraminidase [50943] (8 species) 
Species Influenza A virus (a/northern pintail/washington/40964/2014(h5n2)) [TaxId:1589662] [346256] (1 PDB entry) 
Domain d5hukb1: 5huk B:83-469 [316783]
Other proteins in same PDB: d5huka2, d5hukb2, d5hukc2, d5hukd2
automated match to d4gzpa_
complexed with bma, ca, man, nag
Details for d5hukb1
PDB Entry: 5huk (more details), 2.45 Å
PDB Description: the crystal structure of neuraminidase from a/northern pintail/washington/40964/2014 influenza virus
PDB Compounds: (B:) NeuraminidaseSCOPe Domain Sequences for d5hukb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hukb1 b.68.1.1 (B:83-469) Influenza neuraminidase {Influenza A virus (a/northern pintail/washington/40964/2014(h5n2)) [TaxId: 1589662]}
eyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscspgkcyqfalgqgttlnn
khsngtihdriphrtllmselgvpfhlgtkqvciawsssschdgkawlhvcvtgddrnat
asfiydgmladsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfikegki
vhisplsgsaqhieecscyprypdvrcvcrdnwkgsnrpvidinmadysidssyvcsglv
gdtprnddsssssncrdpnnergnpgvkgwafdngndvwmgrtisedsrsgyetfrvtdg
wttansksqvnrqiivdnnnwsgysgifsvegkscinrcfyvelirgrpqetrvwwtsns
ivvfcgtsgtygtgswpdganinfmpi
SCOPe Domain Coordinates for d5hukb1:
Click to download the PDB-style file with coordinates for d5hukb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5hukb1:
View in 3D
