Lineage for d1b6sd2 (1b6s D:1-78)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694027Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 694028Superfamily c.30.1: PreATP-grasp domain [52440] (7 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 694029Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 694156Protein N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain [52446] (1 species)
  7. 694157Species Escherichia coli [TaxId:562] [52447] (2 PDB entries)
  8. 694162Domain d1b6sd2: 1b6s D:1-78 [31652]
    Other proteins in same PDB: d1b6sa1, d1b6sa3, d1b6sb1, d1b6sb3, d1b6sc1, d1b6sc3, d1b6sd1, d1b6sd3

Details for d1b6sd2

PDB Entry: 1b6s (more details), 2.5 Å

PDB Description: structure of n5-carboxyaminoimidazole ribonucleotide synthetase
PDB Compounds: (D:) protein (n5-carboxyaminoimidazole ribonucleotide synthetase)

SCOP Domain Sequences for d1b6sd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6sd2 c.30.1.1 (D:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]}
mkqvcvlgngqlgrmlrqageplgiavwpvgldaepaavpfqqsvitaeierwpetaltr
elarhpafvnrdvfpiia

SCOP Domain Coordinates for d1b6sd2:

Click to download the PDB-style file with coordinates for d1b6sd2.
(The format of our PDB-style files is described here.)

Timeline for d1b6sd2: