SCOPe 2.07: Domain d4zcba_: 4zcb A:

Lineage for d4zcba_ (4zcb A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein automated matches [190295] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187133] (101 PDB entries)

8. Domain d4zcba_: 4zcb A: [316200]
   automated match to d4ruua_
   mutant

Details for d4zcba_

PDB Entry: 4zcb, 1.7 Å

PDB Description: human crbpii mutant - y60w dimer

PDB Compounds: (A:) Retinol-binding protein 2

SCOPe Domain Sequences for d4zcba_:

Sequence; same for both SEQRES and ATOM records:

>d4zcba_ b.60.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trdqngtwemesnenfegymkaldidfatrkiavrltqtkvidqdgdnfktkttstfrnw
dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkqwiegdklylelt
cgdqvcrqvfkkk

Timeline for d4zcba_:

• d4zcba_ first appeared in SCOPe 2.06
  
• d4zcba_ appears in the current release, SCOPe 2.08