Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
Domain d5ec1b1: 5ec1 B:1-107 [316155] Other proteins in same PDB: d5ec1a1, d5ec1a2, d5ec1a3, d5ec1b2, d5ec1c_ automated match to d4h88l1 complexed with dga, f09, k; mutant |
PDB Entry: 5ec1 (more details), 2.75 Å
SCOPe Domain Sequences for d5ec1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ec1b1 b.1.1.0 (B:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleik
Timeline for d5ec1b1:
View in 3D Domains from other chains: (mouse over for more information) d5ec1a1, d5ec1a2, d5ec1a3, d5ec1c_ |