Lineage for d1ddia2 (1ddi A:447-599)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) 
Family c.25.1.4: NADPH-cytochrome p450 reductase-like [52365] (2 proteins) Protein Sulfite reductase flavoprotein [52368] (1 species) Species Escherichia coli [TaxId:562] [52369] (2 PDB entries) 
Domain d1ddia2: 1ddi A:447-599 [31561]
Other proteins in same PDB: d1ddia1
Details for d1ddia2
PDB Entry: 1ddi (more details), 2.51 Å
PDB Description: crystal structure of sir-fp60
SCOP Domain Sequences for d1ddia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ddia2 c.25.1.4 (A:447-599) Sulfite reductase flavoprotein {Escherichia coli}
lpanpetpvimigpgtgiapfrafmqqraadeapgknwlffgnphftedflyqvewqryv
kegvltridlawsrdqkekvyvqdklreqgaelwrwindgahiyvcgdanrmakdveqal
leviaefggmdteaadeflselrverryqrdvy
SCOP Domain Coordinates for d1ddia2:
Click to download the PDB-style file with coordinates for d1ddia2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ddia2:
- d1ddia2 appears in SCOP 1.57
- d1ddia2 appears in the current release, SCOPe 2.08
View in 3D
