Lineage for d1ddia1 (1ddi A:226-446)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies) 
Superfamily b.43.1: Ferredoxin reductase-like, FAD-binding (N-terminal) domain [50413] (5 families) 
Family b.43.1.5: NADPH-cytochrome p450 reductase-like [50438] (2 proteins) Protein Sulfite reductase flavoprotein [50441] (1 species) Species Escherichia coli [TaxId:562] [50442] (2 PDB entries) 
Domain d1ddia1: 1ddi A:226-446 [25673]
Other proteins in same PDB: d1ddia2
Details for d1ddia1
PDB Entry: 1ddi (more details), 2.51 Å
PDB Description: crystal structure of sir-fp60
SCOP Domain Sequences for d1ddia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ddia1 b.43.1.5 (A:226-446) Sulfite reductase flavoprotein {Escherichia coli}
ihtspyskdaplvaslsvnqkitgrnsekdvrhieidlgdsglryqpgdalgvwyqndpa
lvkelvellwlkgdepvtvegktlplnealqwhfeltvntanivenyatltrsetllplv
gdkaklqhyaattpivdmvrfspaqldaealinllrpltprlysiassqaevenevhvtv
gvvrydvegraraggassfladrveeegevrvfiehndnfr
SCOP Domain Coordinates for d1ddia1:
Click to download the PDB-style file with coordinates for d1ddia1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ddia1:
- d1ddia1 appears in SCOP 1.57
- d1ddia1 appears in the current release, SCOPe 2.08
View in 3D
