Lineage for d4z7eb_ (4z7e B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522523Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2522524Protein automated matches [190039] (158 species)
    not a true protein
  7. 2523053Species Listeria monocytogenes [TaxId:169963] [193523] (5 PDB entries)
  8. 2523058Domain d4z7eb_: 4z7e B: [315602]
    automated match to d1sw5a_
    complexed with 1pe, peg, ppi

Details for d4z7eb_

PDB Entry: 4z7e (more details), 1.5 Å

PDB Description: soluble binding domain of lmo1422 abc-transporter
PDB Compounds: (B:) Lmo1422 protein

SCOPe Domain Sequences for d4z7eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z7eb_ c.94.1.0 (B:) automated matches {Listeria monocytogenes [TaxId: 169963]}
eitiagklgaepeilinmyklviedetdlkvnvkpnmgktsfvfnalksgdidiypeftg
tvletflkenakthdpeevytqardglakdfdmtylkpmkynntyalavspefakennle
kisdlgpvsdqvkagftlefkdrsdgykgiqdkygltfsnlktmepklrynaiksgdinl
ldaystdselaqyklkvleddqqlfppyqgaplmltktldkypelkkplnklagkitdde
mrkmnyevnvngksaytvakdylkdqgiik

SCOPe Domain Coordinates for d4z7eb_:

Click to download the PDB-style file with coordinates for d4z7eb_.
(The format of our PDB-style files is described here.)

Timeline for d4z7eb_: