Lineage for d1ce8g2 (1ce8 G:936-1073)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1358940Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 1358941Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families) (S)
    contains a common phosphate-binding site
  5. 1358942Family c.24.1.1: Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52336] (1 protein)
  6. 1358943Protein Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52337] (1 species)
  7. 1358944Species Escherichia coli [TaxId:562] [52338] (10 PDB entries)
    Uniprot P00968
  8. 1358980Domain d1ce8g2: 1ce8 G:936-1073 [31498]
    Other proteins in same PDB: d1ce8a1, d1ce8a3, d1ce8a4, d1ce8a5, d1ce8a6, d1ce8b1, d1ce8b2, d1ce8c1, d1ce8c3, d1ce8c4, d1ce8c5, d1ce8c6, d1ce8d1, d1ce8d2, d1ce8e1, d1ce8e3, d1ce8e4, d1ce8e5, d1ce8e6, d1ce8f1, d1ce8f2, d1ce8g1, d1ce8g3, d1ce8g4, d1ce8g5, d1ce8g6, d1ce8h1, d1ce8h2
    complexed with adp, cl, imp, k, mn, net, orn, po4

Details for d1ce8g2

PDB Entry: 1ce8 (more details), 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichis coli with complexed with the allosteric ligand imp
PDB Compounds: (G:) protein (carbamoyl-phosphate synthase)

SCOPe Domain Sequences for d1ce8g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ce8g2 c.24.1.1 (G:936-1073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli [TaxId: 562]}
nstmkkhgrallsvregdkervvdlaakllkqgfeldathgtaivlgeaginprlvnkvh
egrphiqdrikngeytyiinttsgrraiedsrvirrsalqykvhydttlnggfatamaln
adatekvisvqemhaqik

SCOPe Domain Coordinates for d1ce8g2:

Click to download the PDB-style file with coordinates for d1ce8g2.
(The format of our PDB-style files is described here.)

Timeline for d1ce8g2: