Lineage for d5hwnd_ (5hwn D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2444607Species Agrobacterium fabrum [TaxId:176299] [314806] (3 PDB entries)
  8. 2444611Domain d5hwnd_: 5hwn D: [314922]
    Other proteins in same PDB: d5hwnb2, d5hwnc2
    automated match to d4ur7a_
    complexed with fmt, gol, pyr

Details for d5hwnd_

PDB Entry: 5hwn (more details), 1.5 Å

PDB Description: crystal structure of keto-deoxy-d-galactarate dehydratase complexed with pyruvate
PDB Compounds: (D:) Probable 5-dehydro-4-deoxyglucarate dehydratase

SCOPe Domain Sequences for d5hwnd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hwnd_ c.1.10.0 (D:) automated matches {Agrobacterium fabrum [TaxId: 176299]}
mdpeqiktalgsgllsfpvthfdaegrfaadsyrehvewlagykapvlfaaggtgeffsl
kpdeiptivaaakevagetaivsgcgygteiavdiarsvekvgadgilllphylidapqe
glyahikkvcqsvgigvmvynrdnsvlqadtlarlcdecpnlvgfkdgtgdiglvrqita
kmgdrlmylggmptaelfaeaylgagfttyssavfnfvpglanefyaalrageratceri
lvdffypfmairnrakgyavsavkagvrlqgfnagpvraplkdltneeigmlealigthk
r

SCOPe Domain Coordinates for d5hwnd_:

Click to download the PDB-style file with coordinates for d5hwnd_.
(The format of our PDB-style files is described here.)

Timeline for d5hwnd_: