Lineage for d5h8ha_ (5h8h A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522523Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2522524Protein automated matches [190039] (158 species)
    not a true protein
  7. 2522959Species Human (Homo sapiens) [TaxId:9606] [193730] (34 PDB entries)
  8. 2522985Domain d5h8ha_: 5h8h A: [314905]
    Other proteins in same PDB: d5h8hb_
    automated match to d4nf8b_
    complexed with 5yc, act, ca, glu, gly

Details for d5h8ha_

PDB Entry: 5h8h (more details), 2.23 Å

PDB Description: structure of the human glun1/glun2a lbd in complex with gne3419
PDB Compounds: (A:) Glutamate receptor ionotropic, NMDA 2A,Glutamate receptor ionotropic, NMDA 2A

SCOPe Domain Sequences for d5h8ha_:

Sequence, based on SEQRES records: (download)

>d5h8ha_ c.94.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dnhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfcid
ilkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevv
dfsvpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypym
hqymtkfnqkgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgy
gialqkgspwkrqidlallqfvgdgemeeletlwltgic

Sequence, based on observed residues (ATOM records): (download)

>d5h8ha_ c.94.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dnhlsivtleeapfvivedidpetcvrntvpcrkfvkinnstnegmnvkkcckgfcidil
kklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvdf
svpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymhq
ymtkfnqkgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgygi
alqkgspwkrqidlallqfvgdgemeeletlwltgic

SCOPe Domain Coordinates for d5h8ha_:

Click to download the PDB-style file with coordinates for d5h8ha_.
(The format of our PDB-style files is described here.)

Timeline for d5h8ha_: