Lineage for d5i5ib2 (5i5i B:499-628)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381958Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2381959Protein automated matches [190824] (29 species)
    not a true protein
  7. 2382408Species Shewanella denitrificans [TaxId:318161] [314881] (3 PDB entries)
  8. 2382412Domain d5i5ib2: 5i5i B:499-628 [314887]
    Other proteins in same PDB: d5i5ia1, d5i5ib1
    automated match to d1qnia1

Details for d5i5ib2

PDB Entry: 5i5i (more details), 2.14 Å

PDB Description: shewanella denitrificans nitrous oxide reductase, app form
PDB Compounds: (B:) nitrous-oxide reductase

SCOPe Domain Sequences for d5i5ib2:

Sequence, based on SEQRES records: (download)

>d5i5ib2 b.6.1.0 (B:499-628) automated matches {Shewanella denitrificans [TaxId: 318161]}
klwtrddpmfadtvamakqdgvtlemdnkvirdgnkvrvymtsiapnfgmnefkvklgde
vtvvvtnldqvedvthgfcmtnhgvqmevapqatasvtfiankpgvqwyycnwfchalhm
emrgrmlvea

Sequence, based on observed residues (ATOM records): (download)

>d5i5ib2 b.6.1.0 (B:499-628) automated matches {Shewanella denitrificans [TaxId: 318161]}
klwtrddpmfadtvamakqdgvtlemdnkvirdgnkvrvymtsiapnfgmnefkvklgde
vtvvvtnldqvedvthgfcmtnhgvqmevapqatasvtfiankpgvqwyycnwfchmemr
grmlvea

SCOPe Domain Coordinates for d5i5ib2:

Click to download the PDB-style file with coordinates for d5i5ib2.
(The format of our PDB-style files is described here.)

Timeline for d5i5ib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5i5ib1