Lineage for d5ftkb3 (5ftk B:201-470)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479032Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2479239Protein Membrane fusion ATPase VCP/p97 [64038] (2 species)
  7. 2479240Species Human (Homo sapiens) [TaxId:9606] [313486] (5 PDB entries)
  8. 2479256Domain d5ftkb3: 5ftk B:201-470 [314586]
    Other proteins in same PDB: d5ftka1, d5ftka2, d5ftkb1, d5ftkb2, d5ftkc1, d5ftkc2, d5ftkd1, d5ftkd2, d5ftke1, d5ftke2, d5ftkf1, d5ftkf2
    automated match to d3cf1a2
    complexed with adp

Details for d5ftkb3

PDB Entry: 5ftk (more details), 2.4 Å

PDB Description: cryo-em structure of human p97 bound to adp
PDB Compounds: (B:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d5ftkb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ftkb3 c.37.1.20 (B:201-470) Membrane fusion ATPase VCP/p97 {Human (Homo sapiens) [TaxId: 9606]}
vgyddiggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan
etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev
errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei
lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae
vmnslavtmddfrwalsqsnpsalretvve

SCOPe Domain Coordinates for d5ftkb3:

Click to download the PDB-style file with coordinates for d5ftkb3.
(The format of our PDB-style files is described here.)

Timeline for d5ftkb3: