Lineage for d5fggp_ (5fgg P:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2600683Domain d5fggp_: 5fgg P: [314571]
    Other proteins in same PDB: d5fgga_, d5fgge_, d5fggg_, d5fggi_, d5fggj_, d5fggk_, d5fggl_, d5fggn_, d5fggo_, d5fggs_, d5fggu_, d5fggw_, d5fggx_, d5fggy_, d5fggz_
    automated match to d1rypc_
    complexed with 3bv, cl, mes, mg; mutant

Details for d5fggp_

PDB Entry: 5fgg (more details), 2.7 Å

PDB Description: yeast 20s proteasome beta5-l(-49s)_d17n double mutant in complex with carfilzomib
PDB Compounds: (P:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d5fggp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fggp_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d5fggp_:

Click to download the PDB-style file with coordinates for d5fggp_.
(The format of our PDB-style files is described here.)

Timeline for d5fggp_: