Lineage for d5fdla2 (5fdl A:430-554)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2495032Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2495033Protein automated matches [190396] (40 species)
    not a true protein
  7. 2495132Species Human immunodeficiency virus 1 [TaxId:11676] [225129] (16 PDB entries)
  8. 2495146Domain d5fdla2: 5fdl A:430-554 [314386]
    Other proteins in same PDB: d5fdla1, d5fdlb_
    automated match to d1bqna1
    complexed with 5dv; mutant

Details for d5fdla2

PDB Entry: 5fdl (more details), 3.1 Å

PDB Description: crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with idx899
PDB Compounds: (A:) p51 Reverse transcriptase

SCOPe Domain Sequences for d5fdla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fdla2 c.55.3.0 (A:430-554) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

SCOPe Domain Coordinates for d5fdla2:

Click to download the PDB-style file with coordinates for d5fdla2.
(The format of our PDB-style files is described here.)

Timeline for d5fdla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5fdla1
View in 3D
Domains from other chains:
(mouse over for more information)
d5fdlb_