Lineage for d1cs0b2 (1cs0 B:153-380)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2467009Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2467010Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 2467021Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species)
  7. 2467022Species Escherichia coli [TaxId:562] [52322] (10 PDB entries)
    Uniprot P00907
  8. 2467031Domain d1cs0b2: 1cs0 B:153-380 [31417]
    Other proteins in same PDB: d1cs0a1, d1cs0a2, d1cs0a3, d1cs0a4, d1cs0a5, d1cs0a6, d1cs0b1, d1cs0c1, d1cs0c2, d1cs0c3, d1cs0c4, d1cs0c5, d1cs0c6, d1cs0d1, d1cs0e1, d1cs0e2, d1cs0e3, d1cs0e4, d1cs0e5, d1cs0e6, d1cs0f1, d1cs0g1, d1cs0g2, d1cs0g3, d1cs0g4, d1cs0g5, d1cs0g6, d1cs0h1
    complexed with adp, cl, k, mn, net, orn, po4

Details for d1cs0b2

PDB Entry: 1cs0 (more details), 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase complexed at cys269 in the small subunit with the tetrahedral mimic l-glutamate gamma-semialdehyde
PDB Compounds: (B:) carbamoyl phosphate synthetase: small subunit

SCOPe Domain Sequences for d1cs0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cs0b2 c.23.16.1 (B:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]}
lngmdlakevttaeayswtqgswtltgglpeakkedelpfhvvaydfgakrnilrmlvdr
gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgiclgh
qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl
fdgtlqgihrtdkpafsfqghpeaspgphdaaplfdhfielieqyrkt

SCOPe Domain Coordinates for d1cs0b2:

Click to download the PDB-style file with coordinates for d1cs0b2.
(The format of our PDB-style files is described here.)

Timeline for d1cs0b2: