Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d5d5me2: 5d5m E:111-200 [313634] Other proteins in same PDB: d5d5ma1, d5d5ma2, d5d5mb_, d5d5mc1, d5d5mc2, d5d5md1, d5d5md2, d5d5me1, d5d5mf1, d5d5mf2, d5d5mg1, d5d5mh1, d5d5mh2 automated match to d2f54d2 complexed with 2lj, act, gol |
PDB Entry: 5d5m (more details), 2.2 Å
SCOPe Domain Sequences for d5d5me2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d5me2 b.1.1.2 (E:111-200) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffpsp
Timeline for d5d5me2: