Lineage for d5dgcb_ (5dgc B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2463696Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2463980Protein automated matches [190177] (9 species)
    not a true protein
  7. 2464033Species Escherichia coli [TaxId:83334] [313252] (3 PDB entries)
  8. 2464037Domain d5dgcb_: 5dgc B: [313600]
    automated match to d3ffwa_
    complexed with bef, cl, gol, imd, mn

Details for d5dgcb_

PDB Entry: 5dgc (more details), 1.94 Å

PDB Description: reaction of phosphorylated chey with imidazole 2 of 3
PDB Compounds: (B:) Chemotaxis protein cheY

SCOPe Domain Sequences for d5dgcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dgcb_ c.23.1.1 (B:) automated matches {Escherichia coli [TaxId: 83334]}
adkelkflvvddqstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwkmp
nmdglellktiradgamsalpvlmvtayakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

SCOPe Domain Coordinates for d5dgcb_:

Click to download the PDB-style file with coordinates for d5dgcb_.
(The format of our PDB-style files is described here.)

Timeline for d5dgcb_: