SCOP 1.65: Domain d1wab__: 1wab -

Lineage for d1wab__ (1wab -)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGHN hydrolase [52266] (5 families)

5. Family c.23.10.3: Acetylhydrolase [52273] (1 protein)

6. Protein Platelet-activating factor acetylhydrolase [52274] (2 species)

7. Species Cow (Bos taurus), alpha1 [TaxId:9913] [52275] (6 PDB entries)

8. Domain d1wab__: 1wab - [31341]
   complexed with act

Details for d1wab__

PDB Entry: 1wab, 1.7 Å

PDB Description: platelet-activating factor acetylhydrolase

SCOP Domain Sequences for d1wab__:

Sequence; same for both SEQRES and ATOM records:

>d1wab__ c.23.10.3 (-) Platelet-activating factor acetylhydrolase {Cow (Bos taurus), alpha1}
enpaskptpvqdvqgdgrwmslhhrfvadskdkepevvfigdslvqlmhqceiwrelfsp
lhalnfgiggdstqhvlwrlengelehirpkivvvwvgtnnhghtaeqvtggikaivqlv
nerqpqarvvvlgllprgqhpnplreknrrvnelvraalaghprahfldadpgfvhsdgt
ishhdmydylhlsrlgytpvcralhslllrll

Timeline for d1wab__:

• d1wab__ first appeared (with stable ids) in SCOP 1.55
  
• d1wab__ appears in SCOP 1.63
  
• d1wab__ appears in SCOP 1.67
  
• d1wab__ appears in the current release, SCOPe 2.08, called d1waba_